CDS

Accession Number TCMCG020C00819
gbkey CDS
Protein Id RAL38125.1
Location complement(join(9663721..9663792,9664735..9665001))
Organism Cuscuta australis
locus_tag DM860_000819

Protein

Length 112aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA394036, BioSample:SAMN07347267
db_source NQVE01000215.1
Definition hypothetical protein DM860_000819 [Cuscuta australis]
Locus_tag DM860_000819

EGGNOG-MAPPER Annotation

COG_category G
Description RuBisCO catalyzes two reactions the carboxylation of D- ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate in the photorespiration process. Both reactions occur simultaneously and in competition at the same active site
KEGG_TC -
KEGG_Module M00165        [VIEW IN KEGG]
M00166        [VIEW IN KEGG]
M00532        [VIEW IN KEGG]
KEGG_Reaction R00024        [VIEW IN KEGG]
R03140        [VIEW IN KEGG]
KEGG_rclass RC00172        [VIEW IN KEGG]
RC00859        [VIEW IN KEGG]
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
KEGG_ko ko:K01601        [VIEW IN KEGG]
EC 4.1.1.39        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko00630        [VIEW IN KEGG]
ko00710        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
ko01120        [VIEW IN KEGG]
ko01200        [VIEW IN KEGG]
map00630        [VIEW IN KEGG]
map00710        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
map01120        [VIEW IN KEGG]
map01200        [VIEW IN KEGG]
GOs GO:0000312        [VIEW IN EMBL-EBI]
GO:0000313        [VIEW IN EMBL-EBI]
GO:0000314        [VIEW IN EMBL-EBI]
GO:0001101        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005576        [VIEW IN EMBL-EBI]
GO:0005618        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0005840        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009526        [VIEW IN EMBL-EBI]
GO:0009532        [VIEW IN EMBL-EBI]
GO:0009534        [VIEW IN EMBL-EBI]
GO:0009535        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009547        [VIEW IN EMBL-EBI]
GO:0009570        [VIEW IN EMBL-EBI]
GO:0009579        [VIEW IN EMBL-EBI]
GO:0009719        [VIEW IN EMBL-EBI]
GO:0009725        [VIEW IN EMBL-EBI]
GO:0009737        [VIEW IN EMBL-EBI]
GO:0009941        [VIEW IN EMBL-EBI]
GO:0010033        [VIEW IN EMBL-EBI]
GO:0010035        [VIEW IN EMBL-EBI]
GO:0010038        [VIEW IN EMBL-EBI]
GO:0010287        [VIEW IN EMBL-EBI]
GO:0015935        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0022626        [VIEW IN EMBL-EBI]
GO:0030312        [VIEW IN EMBL-EBI]
GO:0031967        [VIEW IN EMBL-EBI]
GO:0031975        [VIEW IN EMBL-EBI]
GO:0031976        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0033993        [VIEW IN EMBL-EBI]
GO:0034357        [VIEW IN EMBL-EBI]
GO:0042221        [VIEW IN EMBL-EBI]
GO:0042651        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043228        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043232        [VIEW IN EMBL-EBI]
GO:0044391        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044436        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044445        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046686        [VIEW IN EMBL-EBI]
GO:0048046        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0055035        [VIEW IN EMBL-EBI]
GO:0071944        [VIEW IN EMBL-EBI]
GO:0097305        [VIEW IN EMBL-EBI]
GO:1901700        [VIEW IN EMBL-EBI]
GO:1990904        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGTCACCACAAACAGAGACTAAAACAAGTGTTGGTTTCAAAGCTGGTGTTAAAGACTACAAATTAACGTATTATACTCCTGATTATGAAACCAAAGCTACTGATATCTTAGGAGCATTTCGAGTAACTCCGCAACCAGGTGTTCCACCTGAAGAAGCCGGGGCTGCAATTGTTGCGGAATCTTCTACTGGTACATGGACAACTGTGTGGACTGATGGATTGACTAGCCTAGATCGGTACAAGGGTCGATGCTATCATATTGAGCGCGGAATTGTATTTTCACAAAGGGTAACCCGAGAGGGAATGCTTTGGAGGGGTAAGCTAGGTACGCCCGCATAA
Protein:  
MSPQTETKTSVGFKAGVKDYKLTYYTPDYETKATDILGAFRVTPQPGVPPEEAGAAIVAESSTGTWTTVWTDGLTSLDRYKGRCYHIERGIVFSQRVTREGMLWRGKLGTPA